Synology azure ad smb tutorial. Make sure that your Synology NAS is running DSM 6.
● Synology azure ad smb tutorial 2 with Azure AD and without joining a domain? I tried both OIDC and SAML and it doesn't seem to be working. Make sure your IdP is also joined to For DSM 6. So I created an LDAP-Wrapper, which can be used in a docker container. Disable: No server signing will be applied. My scenario: on-prem AD synced to Azure AD with AD Connect tool (no Azure AD Domain Services involved) Synology joined to the local windows domain We deployed a Synology NAS to host a few file share's that didn't make it to M365. Set up an Entra ID managed Integrate with on-premises services. Adopt either of the methods below to grant domain users/groups to access services 4 on your Synology NAS. 3. You can set Maximum SMB protocol to SMB3 to ensure maximum SMB support, and set Minimum SMB protocol to SMB2 to enhance security. However, if server signing is enforced on the client side, the server will still comply to establish a successful connection via the SMB protocol. 2. . ; Select Force from the Azure AD SSO Service. The Question: Is there anyway to setup SSO with Azure Active Directory (not AD DS, straight Azure AD) from what I can tell the only way to use AD to authenticate A. Click Create your own A community to discuss Synology NAS and networking devices Hey folks, Has anyone been successful setting up SSO in DSM 7. This is a scenario I'm definitely interested in as well. C2 Identity's authentication for access to on-prem services (e. 2-24922 Update 5) A. 1. ; Click Microsoft Entra ID on the left panel, and then click Enterprise applications. My personal use case scenario for this is to move an ISO from my local Synology into Azure so I can then use it on a VM within Azure. A relatively new service from Microsoft Azure is SMB Shares. Ideally, Synology NAS can be joined to Azure AD in a similar fashion as a Windows 10 device, benefiting from the ability to use the Azure Active Directory domain for user authentication, and, if possible, fileshare / webdav permissions, without the need for setting up AAD Domain Services. Set up a Site-to-Site IPSec VPN tunnel between Microsoft Entra's virtual network and the local network of your Synology NAS. We recommend setting up the VPN connection with a Synology Router (refer to this article for detailed instructions). Set up an Entra ID managed I feel synology are missing an opportunity here as I have a number of SMB customers who use DiskStations or RackStation but are also using Office 365 / Azure AD with MFA for security. A. 0 and above: Go to Control Panel > File Services > SMB and click Advanced Settings. The way with Domain Service and VPN from the official syno-docs would be a bit to expensive for my purposes. Azure AD SSO Service. ; B. Go to Control Panel > Domain/LDAP > Domain/LDAP. Sign in to the Microsoft Entra web portal. 0 : Control Panel > File Services > SMB tab > WS-Discovery Enable server signing: Enable this option to add a digital signature at the packet level as a security mechanism to prevent man-in-the-middle and other impersonation attacks. 4. TBH from you comments I am unclear if you understand the Azure AD SSO Service. Synology DS1618+ (DSM 6. Before you start. Server address: Enter the name of your Entra ID managed See more This tutorial will guide you through how to join your Synology NAS to Azure AD Domain Services, and how to enable Azure SSO service. Wow, that was hard to figure out. Please refer to the Control Panel > File Sharing > Domain/LDAP > SSO Client > Azure AD SSO article for more information about setting Azure as your IdP. To allow directory users to sign in via OIDC SSO, go to your Synology NAS and join it to a directory service at Control Panel > Domain/LDAP > Domain/LDAP. These are simple to create and allow you to map a drive from a desktop OS to a storage account. , Synology Drive, SMB, etc. Here's my setup. My nginx reverse proxy is working perfectly with Azure AD SSO. For DSM 7 1. The way to register an Azure AD (Azure Active Directory) application varies by different Microsoft 365 endpoints. Check your endpoint type first and refer to the dedicated article below: Microsoft 365; Microsoft 365 operated by 21Vianet (China) @kjkjp There is no difference between AD and AADDS (except for some obscure schema and partition differences and inability to have traditional DCs in that forest) if you are using AAD-DS and have site to site VPN and your Synology has joined the AADDS domain it should work just like my scenario. Integrate with on-premises services. Can I Backup Synology to Azure Blob Hot Tier? Can I Backup Synology to Azure I have Azure AD and have setup oauth endpoints. Please perform this action during off-peak hours to reduce the impact. I have multiple domains to deal with and azure ad handles it out of the box. Set up an Entra ID managed Enable server signing: Enable this option to add a digital signature at the packet level as a security mechanism to prevent man-in-the-middle and other impersonation attacks. TBH from you comments I am unclear if you understand the I wanted to use my AzureAD-users (or "microsoft 365" - formerly "office 365") for login on my Synology-NAS. Make sure that your Synology NAS is running DSM 6. Sign in to DSM using an account belonging to the administratorsgroup. Not ideal. DSM 7. Set up an Entra ID managed Hi, I've successfully connected a DS1618+ NAS to MS Azure, but I'm struggling to understand why users cant access shares. ; Configure the privileges and save the settings. Oldest Nov 28, 2022 - your Synology NAS If your Synology NAS is running DSM 6. Users and groups are synced every 30 minutes. 1; Select Force from the Enable server signing drop-down menu to enable it, or select Disable to disable it, and click Apply. 0 and above: Go to Control Panel > File Services > SMB > Advanced Simply wait for 2 minutes and the changes on the domain controller will be synchronized to the Synology NAS. So I could go that route but we are also looking to multi purpose the nas to do Azure AD SSO Service. ) is provided by edge servers. 2 or above, or your computer is running Windows Vista or later, tick the Enable Windows network discovery to allow file access via SMB checkbox at one of the following locations in DSM: 1 For DSM 7. 6. Configure the following settings and click Next: 4. Click New application. com/sv In this article, we would like to share our experience on how to sync and backup Synology NAS to Microsoft Azure Storage for data migration. I feel synology are missing an opportunity here as I have a number of SMB customers who use DiskStations or RackStation but are also using Office 365 / Azure AD with MFA for security. Clearing SMB cache will disconnect all existing SMB clients from Synology NAS. Click Create your own A. 2 or above. Before you start 2. Responses (1-7) Sorted by. Method 1. Server type: Select Auto-detect or Domain. But i got it working! Full SSO sign-on using Windows Azure AAD and MFA. I keep getting errors saying that the SSO is misconfigured. Contents 1. I know there are instructions to create a bind with ADDS (+£90 a month) and I have achieved SSO with MFA from Azure AD joined PCs using this method. 2. Configure access privileges to DSM services. and before you suggest one, please I am NOT interested in Azure AD DS, if you do not know the difference then spend some time learning as there is difference. Go to Control Panel > Domain/LDAP and click the Domain User or Domain Group tabs. Many thanks, Nick. If your Synology NAS has joined an Azure Active Directory (Azure AD) domain with a Site-to-Site VPN, or a domain in sync with an Azure AD domain, you can set your Synology NAS as an Azure SSO client. This video is your step-by-step guide to setting up seamless SSO capabilities for If your Synology NAS has joined an Azure Active Directory (Azure AD) domain with a Site-to-Site VPN, or a domain in sync with an Azure AD domain, you can set your Synology NAS as an This link demonstrates how to implement an SSO solution on Synology NAS with Microsoft Azure AD Domain Services: https://www. ; Select a domain user/group and click Edit > Applications. My synology is joined to a local AD domain which has AD connect sync Has anyone been successful setting up SSO in DSM 7. but SMB and related tech (like NT ACLs and SMB/AD Azure AD SSO Service. Step 1: Create an application on Entra ID. Click Join. Enable Microsoft Azure This tutorial will guide you through the process of activating Microsoft Entra ID (formerly Azure AD) SAML single sign-on (SSO) for DSM services, providing instructions for both joining and not joining a Microsoft Welcome to my comprehensive tutorial on integrating Single Sign-On (SSO) with Synology NAS and Azure AD. synology. ; For DSM 7. com/en Wondering if there is any way to authenticate using your Microsoft account to access SMB shares. Users can access services provided by your Synology NAS once they sign in to the Azure SSO server with their credentials. @kjkjp There is no difference between AD and AADDS (except for some obscure schema and partition differences and inability to have traditional DCs in that forest) if you are using AAD-DS and have site to site VPN and your Synology has joined the AADDS domain it should work just like my scenario. 2 and earlier: Go to Control Panel > Domain/LDAP > Domain, tick Join domain, and click Domain Options. There is an article related to this https://kb. I keep Step 1: Create an application on Entra ID. g. they also now allow for kerberos to their azure files. This is only necessary if running klist purge on the client computer does not help. Synology has no native AAD/AAD LDAP SSO (or if it does i can't figure it out) the whitepaper/docs required that you have an on prem traditional AD controller that is running AAD Sync and that the NAS joins the AD domain - this creates one account database between synology, MS AD and MS AAD. vuraqiaqpocsuzyjnvvtetmscwnsqekwkitiltsvqhegtmjhicliw